PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN00880.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 274aa    MW: 31855.8 Da    PI: 6.5948
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN00880.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding569.3e-181562148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+W++eEd++l ++v+ +G g W+  +++ g++R++k+c++rw++yl
       KHN00880.1 15 RGPWSAEEDKILMNYVQVHGEGKWRELSKRAGLKRCGKSCRLRWLNYL 62
                     89********************************************97 PP

2Myb_DNA-binding52.71e-1668113148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+ + +E++l+++++k+lG++ W++Ia +++ gRt++++k++w++yl
       KHN00880.1  68 RGNISSDEEDLIIRLHKLLGNR-WSLIAGRLP-GRTDNEIKNYWNTYL 113
                      78999*****************.*********.*************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.3161062IPR017930Myb domain
SuperFamilySSF466893.52E-3013109IPR009057Homeodomain-like
SMARTSM007172.3E-141464IPR001005SANT/Myb domain
PfamPF002492.1E-161562IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.9E-241669IPR009057Homeodomain-like
CDDcd001671.03E-101762No hitNo description
PROSITE profilePS5129426.01863117IPR017930Myb domain
SMARTSM007175.4E-1667115IPR001005SANT/Myb domain
PfamPF002494.8E-1568113IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.5E-2470116IPR009057Homeodomain-like
CDDcd001675.35E-1172113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 274 aa     Download sequence    Send to blast
MGRKANCDNQ YAMNRGPWSA EEDKILMNYV QVHGEGKWRE LSKRAGLKRC GKSCRLRWLN  60
YLKPDIKRGN ISSDEEDLII RLHKLLGNRW SLIAGRLPGR TDNEIKNYWN TYLRKKAEHK  120
HDKIPSHNDN IPIKLRIESP GCSKNSFGNV LDPTKSPHPM RCTKVMMPVN DSVNTTNLIT  180
TSWDNHNPSS ASMQLDDYNH CLTGVLQEFD ISDLLMSYED DFRFNGYACV EIPQHIFEDE  240
TCRLDDSLGE EAWYENWKND PYFPQDQDMG FSSF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C6e-281311725128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150413e-55AP015041.1 Vigna angularis var. angularis DNA, chromosome 8, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003555449.10.0PREDICTED: transcription factor WER-like
TrEMBLA0A0B2NV120.0A0A0B2NV12_GLYSO; Transcription repressor MYB5
TrEMBLI1NHJ30.0I1NHJ3_SOYBN; Uncharacterized protein
STRINGGLYMA20G32500.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF15511512
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13540.12e-58myb domain protein 5
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]